PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_02905
Common NameDof25, KK1_002974
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Dof
Protein Properties Length: 244aa    MW: 27059.7 Da    PI: 7.3101
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_02905genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.22.1e-392787262
         zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                   +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk+k+ss
  C.cajan_02905 27 NHQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSS 87
                   57899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-262580IPR003851Zinc finger, Dof-type
PfamPF027011.5E-332985IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.733185IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MQEIHSIGGA RFFSGAADRR LRPHHQNHQA LKCPRCDSLN TKFCYYNNYN LSQPRHFCKN  60
CRRYWTKGGV LRNVPVGGGC RKSKRSSKPP SDSAPPPPPD PDRSSSDSST LTATATTHSH  120
SHSHMQHSVL ETTPLDQPSG TDSAAIFSEI GPFTASSSND SLAFAFPDAS SFPWQHPKRD  180
EEFSSLLDHT VDFSAKPPHA AFGPLDWHAT ADQGLFDLPN AVDHAYWTHS HWSDNDNSTL  240
FHLP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6629170.0KP662917.1 Cajanus cajan Dof25 (Dof25) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014630893.11e-102PREDICTED: dof zinc finger protein DOF5.4-like
SwissprotQ8LDR02e-56DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLA0A0K8K6480.0A0A0K8K648_CAJCA; Dof protein
STRINGGLYMA05G07460.11e-101(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.15e-38OBF binding protein 4
Publications ? help Back to Top
  1. Malviya N, et al.
    Genome wide in silico characterization of Dof gene families of pigeonpea (Cajanus cajan (L) Millsp.).
    Mol. Biol. Rep., 2015. 42(2): p. 535-52
    [PMID:25344821]